PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00005383-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family BBR-BPC
Protein Properties Length: 290aa    MW: 32299 Da    PI: 10.1112
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00005383-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind345.61.1e-10512901301
              GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki....rernlalsekkaavaerd..........maflqrdkalaernkal 74 
                            md+d+   rn+gyyep   lk  lglqlmss+aerd+k+    r++ + + + ++a+++rd          m++  rd+++++     
  SMil_00005383-RA_Salv   1 MDEDSL--RNWGYYEPP--LK-GLGLQLMSSLAERDTKPflsgRDNPV-MVSANGAFHHRDcvvteppvthMDY-VRDSWINH----- 76 
                            788855..9********..77.9******************9776666.99***********************.9******9..... PP

              GAGA_bind  75 verdnkllalllvenslasalpvgvqvlsgtk.sidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpke 161
                               ++k+l++ +        +p +++vl +++ s + +q++++pq ++++++   e  +e+ p  e++ ++ke+   kkr+ a++pk+
  SMil_00005383-RA_Salv  77 ---REKFLHMFPG-------NP-YSSVLAESSgSHHPMQMVQQPQQQPPQQQ--PETAKETRPSMEEPVVKKESGPAKKRAAAATPKT 151
                            ...7899999993.......33.34444444404455677777776655544..4444566666777999999999999********* PP

              GAGA_bind 162 kkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstk 249
                            +kakk++k++ ++k++ + + + +r+k+ kk++++v+ng+++D++++P+PvCsCtG+++qCY+WG+GGWqSaCCtttiS+yPLP+s k
  SMil_00005383-RA_Salv 152 PKAKKPRKNP-APKENGNGNPSVQRAKTAKKNVEVVINGIDMDITGIPIPVCSCTGTPQQCYRWGCGGWQSACCTTTISMYPLPMSQK 238
                            ********65.5555555444458**************************************************************** PP

              GAGA_bind 250 rrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                            rrgaRiagrKmSqgafkk+LekLaaeGy+++np+DL+++WAkHGtnkfv ir
  SMil_00005383-RA_Salv 239 RRGARIAGRKMSQGAFKKVLEKLAAEGYNFANPIDLRTYWAKHGTNKFVIIR 290
                            **************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012264.0E-1661290IPR010409GAGA-binding transcriptional activator
PfamPF062172.4E-1174290IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MDEDSLRNWG YYEPPLKGLG LQLMSSLAER DTKPFLSGRD NPVMVSANGA FHHRDCVVTE  60
PPVTHMDYVR DSWINHREKF LHMFPGNPYS SVLAESSGSH HPMQMVQQPQ QQPPQQQPET  120
AKETRPSMEE PVVKKESGPA KKRAAAATPK TPKAKKPRKN PAPKENGNGN PSVQRAKTAK  180
KNVEVVINGI DMDITGIPIP VCSCTGTPQQ CYRWGCGGWQ SACCTTTISM YPLPMSQKRR  240
GARIAGRKMS QGAFKKVLEK LAAEGYNFAN PIDLRTYWAK HGTNKFVIIR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070518.10.0PREDICTED: protein BASIC PENTACYSTEINE1-like
SwissprotQ9SKD01e-104BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A022QNC41e-159A0A022QNC4_ERYGU; Uncharacterized protein
STRINGVIT_01s0011g06380.t011e-142(Vitis vinifera)
STRINGPGSC0003DMT4000757031e-143(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA90612429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.33e-93basic pentacysteine 2